GSTK1, 1-226aa, Human, E.coli

Categories: [Proteins / Peptides]
GSTK1 is a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification process. This protein catalyzes the conjugation of the thiol group of glutathione (GSH) to the electrophilic groups of a wide range of hydrophobic substrates, leading to an easier removal of the latter from the cells. Recombinant GSTK1 protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02352
Size 100 µg
Host E.coli
Accession
Molecular Weight 25.5 kDa (226aa)
AP_Mol_Weight
Tag
Sequences MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay
Formulation Liquid. In 20mM Tris buffer(pH 8.0) containing 10% glycerol 1mM DTT.
Other Names Glutathione S-transferase kappa 1, GST, GST13, GST13-13, GSTK1-1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap