Home / Products / proteins / GRB2, 1-217 aa, Human, His-tagged, Recombinant, E.coli

GRB2, 1-217 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Growth factor receptor-bound protein 2 also known as Grb2 is an adaptor protein that provides a critical link between cell surface growth factor receptors and the Ras signaling pathway. GRB2 is widely expressed and also binds the epidermal growth factor receptor and contains one SH2 domain and two SH3 domains. Grb2 is composed of an SH2 domain flanked on each side by an SH3 domain.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02331
Size 100 µg
Host E.coli
Accession
Molecular Weight 27 kDa (237 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl (pH8.0) buffer containing 30% glycerol
Other Names Growth factor receptor-bound protein 2 isoform 1, ASH, EGFRBP-GRB2, GRB3-3
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap