GPC4, 401-529aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
Glypican 4, also known as GPC4, is a family of glycosylphosphatidylinositol (GPI)-anchored heparan sulphate proteoglycans (HSPGs) that may play a role in the control of cell division and growth regulation. GPC4 is widely expressed in human tissues, including lung, kidney, heart, placenta, skeletal muscle, and pancreas. GPC4 has also been shown to be present in astrocytes, haematopoietic-progenitor and bone-marrow-stromal cells. Recombinant human GPC4 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02314
Size 50 µg
Host E.coli
Accession
Molecular Weight 18 kDa (165aa) confirmed by MALDI-TOF (Molecular size on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSSSLPSNVCNDERMAAGNGNEDDCWNGKGKSRYLFAVTGNGLANQGNNPEVQVDTSKPDILILRQIMALRVMTSKMKNAYNGNDVDFFDISDESSGEGSGSGCEYQQCPSEFDYNATDHAGKSANEKADS
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 10% glycerol
Other Names Glypican 4 , dJ900E8.1, glypican proteoglycan 4
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap