GOSR2, 1-190aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Golgi SNAP receptor complex member 2 isoform A, also known as GOSR2, belongs to the SNARE protein family and are important trafficking proteins between the endoplasmic reticulum and the Golgi and between Golgi subcompartments. This protein exists as cytoplasmically oriented integral membrane proteins. The human GOSR2 gene, which maps to chromosome 17q21, is located near a locus implicated in familial essential hypertension, indicating that it is a potential candidate gene for this disease. Recombinant human GOSR2 protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02306
Size 20 µg
Host E.coli
Accession
Molecular Weight 24.6 kDa (213aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDK
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1M Urea, 10% glycerol
Other Names Golgi SNAP receptor complex member 2 isoform A, Bos1, EPM6, GS27, Membrin
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap