Home / Products / proteins / GOPC, 278-454aa, Human, His tag, E.coli

GOPC, 278-454aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
GOPC, also known as PIST, is a PDZ domain-containing Golgi protein. This protein functions as a homooligomer that interacts with a variety of proteins and plays a role in intracellular protein trafficking and degradation. Additionally, GOPC is thought to regulate ionic currents via membrane channel modification and may also play a role in autophagy.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02303
Size 100 µg
Host E.coli
Accession
Molecular Weight 21.5 kDa (198aa) (Real molecular weight on SDS-PAGE will be shifted up)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol1mM DTT.
Other Names Golgi-associated PDZ and coiled-coil motif-containing protein, CAL, dJ94G16.2, FIG, GOPC1, PIST
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap