GNG4, 1-72aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4 precursor, also known as GNG4, is members of a multigene family and are implicated in determining the specificity of receptor-G protein interaction. In mammals, G protein alpha, beta and gamma polypeptides are encoded by at least 16, 4 and 7 genes, respectively. GNG4 is becoming increasingly clear that different G protein complexes expressed in different tissues carry structurally distinct members of the gamma as well as the alpha and beta subunits and that preferential association between members of subunit families increase G protein functional diversity. Recombinant human GNG4 protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02295
Size 50 µg
Host E.coli
Accession
Molecular Weight 10.4 kDa (95aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKFFC
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea, 10% glycerol
Other Names Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4 precursor , Guanine nucleotide binding protein (G protein), gamma 4
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap