Home / Products / proteins / GMFB, 1-142aa, Human, His tag, E.coli

GMFB, 1-142aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
GMFB, also known as GMF, belongs to the GMF subfamily of the larger actin-binding protein ADF family. This protein, which is phosphorylated following phorbol ester stimulation, is important for the nervous system. It causes brain cell differentiation, stimulates neural regeneration and inhibits tumor cell proliferation. Overexpression of GMFB in astrocytes has been shown to enhance brain-derived neurotrohic factor (BDNF) production.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02280
Size 100 µg
Host E.coli
Accession
Molecular Weight 18.8 kDa (162aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 0.1M NaCl,1mM DTT, 10% glycerol
Other Names Glia maturation factor beta, GMF, GMF beta
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap