GMF-γ, 1-142 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Glia maturation factor gamma (GMF-gamma) is a cytokine-responsive protein in erythropoietininduced and granulocyte-colony stimulating factor-induced hematopoietic lineage development. Also Glia maturation factor is a nerve growth factor implicated in nervous system development, angiogenesis and immune function. GMF-gamma possesses hematopoietic tissue-specific gene expression, a promoter concentrated with high-score hematopoiesis-specific transcription factors, and possible molecular coevolution with a rudimentary blood/immune system.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02279
Size 100 µg
Host E.coli
Accession
Molecular Weight 16.8 kDa (142 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl (pH8.0) containing 1 mM DTT, 1 mM EDTA10% glycerol
Other Names Glia maturation factor, gamma
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap