Glyoxalase I, 1-184 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Glyoxalase I, also known as GLO1, belongs to the glyoxalaseⅠfamily. Glyoxalase I is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutathione.This enzyme is ubiquitously expressed and is also present in many tumor cell lines, in which its concentration is often upregulated. Recombinant human GLO1 protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $248
  • Buy 5 for $235.6 each and save 5%
  • Buy 21 for $223.2 each and save 10%
  • Buy 31 for $210.8 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02276
Size 100 µg
Host E.coli
Accession
Molecular Weight 20.7 kDa (184 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 1 mM DTT, 10% glycerol
Other Names Lactoylglutathione lyase, Glx 1, GLO-1 Methylglyoxalase, Aldoketomutase
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap