GLYATL2, 1-294aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
GLYATL2 belongs to the glycine N-acyltransferase family. This protein is expressed at highest levels in salivary gland and trachea. It is a mitochondrial acyltransferase which transfers the acyl group to the N-terminus of glycine. GLYATL2 conjugates numerous substrates, such as arachidonoyl-CoA and saturated medium and long-chain acyl-CoAs ranging from chain-length C8:0-CoA to C18:0-CoA, to form a variety of N-acylglycines. Recombinant human GLYATL2 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02273
Size 50 µg
Host E.coli
Accession
Molecular Weight 36.7kDa (317aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMLVLHNSQKLQILYKSLEKSIPESIKVYGAIFNIKDKNPFNMEVLVDAWPDYQIVITRPQKQEMKDDQDHYTNTYHIFTKAPDKLEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNKEGNFSNMFLDASHAGLVNEHWAFGKNERSLKYIERCLQDFLGFGVLGPEGQLVSWIVMEQSCELRMGYTVPKYRHQGNMLQIGYHLEKYLSQKEIPFYFHVADNNEKSLQALNNLGFKICPCGWHQWKCTPKKYC
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by BRADFORD assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 50% glycerol, 2mM DTT
Other Names glycine N-acyltransferase-like protein 2 , BXMAS2-10, GATF-B
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap