Home / Products / proteins / Glutaredoxin-1,1-106aa, Human, Recombinant, E.coli

Glutaredoxin-1,1-106aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Glutaredoxin(GRX), also known as thioltransferase, is member of the thiol-disulfide oxidoreductase family. Glutraredoxin catalyzes the reversible reduction of protein-glutathionyl mixed disulfides to free sulfhydryl groups though a monothiol mechanism. Mammalian Glutaredoxin is known to have two isoforms, GRX1 and GRX2. GRX1 is a cytosolic protein, whereas GRX2 is localized both in the mitochondria and nucleus.
List Price: $248
  • Buy 5 for $235.6 each and save 5%
  • Buy 21 for $223.2 each and save 10%
  • Buy 31 for $210.8 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02267
Size 100 µg
Host E.coli
Accession
Molecular Weight 11.7 kDa (106 aa) , confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 1 mM DTT 10% glycerol
Other Names GLRX, GRX, GRX1, Thioltransferase-1, TTase-1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap