GLUL, 1-373aa, Human, E.coli (Bioactivity Validated)

Categories: [Proteins / Peptides]
GLUL also known as Glutamine synthetase. It is a trimetallic enzyme containing two divalent cation sites and one monovalent cation site per subunit. GLUL is able to regulate intracellular concentrations of glutamate and catalyzes the synthesis of glutamine form glutamate and ammonia. It is ubiquitously expressed in the human and plays a major role for many metabolic pathways such as cell proliferation, inhibition of apoptosis, and cell signaling. Recombinant Human GLUL was expressed in E.coli and purified by using conventional chromatography techniques
List Price: $131
  • Buy 5 for $124.45 each and save 5%
  • Buy 21 for $117.9 each and save 10%
  • Buy 31 for $111.35 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02264
Size 20 µg
Host E.coli
Accession
Molecular Weight 42kDa (373aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm )
Formulation Liquid. In 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol, 1mM DTT, 0.1mM PMSF
Other Names Glutamine synthetase , GLNS, GS, PIG43, PIG59, cell proliferation-inducing protein 59, GLNA, GLNA_HUMAN, GLNS, GLULGlutamate ammonia ligase.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap