GLRX5, 1-157aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
GLRX5 is small redox enzymes of approximately one hundred amino-acid residues which uses glutathione as a cofactor. This protein is oxidized by substrates, and reduced non-enzymatically by glutathione. It is involved in the biogenesis of iron-sulfur clusters, which are required for normal iron homeostasis. Recombinant ㅗ human GLRX5 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02258
Size 100 µg
Host E.coli
Accession
Molecular Weight 18.8 kDa (177aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSGSLGRAAAALLRWGRGAGGGGLWGPGVRAAGSGAGGGGSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIHSALLDEKKDQDSK
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol0.1M NaCl
Other Names Glutaredoxin-related protein 5, mitochondrial, C14orf87, GRX5
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap