Glo1, 1-184aa, Mouse, His tag, Baculovirus (Bioactivity Validated)

Categories: [Proteins / Peptides]
Glo1, also known as lactoylglutathione lyase, is a member of the glyoxalase l family. It plays a critical role in the detoxification of 2-oxoaldehydes, such as methylglyoxal. It involved in the regulation of TNF-induced transcriptional activity of NF-kappa-B. It was identified as a protein marker, which is consistently expressed to a higher extent in LAB-M than in HAB-M mice in several brain areas. Recombinant mouse Glo1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $154
  • Buy 5 for $146.3 each and save 5%
  • Buy 21 for $138.6 each and save 10%
  • Buy 31 for $130.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02254
Size 10 µg
Host Baculovirus
Accession
Molecular Weight 21.8kDa (192aa), 28-40kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences MAEPQPASSGLTDETAFSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPAMKFSLYFLAYEDKNDIPKDKSEKTAWTFSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKIATIILEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Glyoxalase 1, Lactoylglutathione lyase, 0610009E22Rik, 1110008E19Rik, 2510049H23Rik, AW550643, Glo-1, Glo-1r, Glo-1s, Glo1-r, Glo1-s, GLY1, Qglo
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap