GIP, 22-153aa, Human His tag, E.coli

Categories: [Proteins / Peptides]
GIP, also known as glucose-dependent insulinotropic polypeptide, is an important insulin-releasing hormone of the enteroinsular axis that has a functional profile of possible therapeutic value for type 2 diabetes. This protein is an important incretin hormone released into the circulation from endocrine K-cells of the duodenum and jejunum after ingestion of food1. It was evaluated for their ability to elevate cellular cAMP production and stimulate insulin secretion. It also promotes plasma triglyceride clearance in response to oral fat loading. In liver, GIP has been shown to enhance insulin-dependent inhibition of glycogenolysis. Recombinant human GIP protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02243
Size 50 µg
Host E.coli
Accession
Molecular Weight 17.3 kDa(155aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSEKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALELAGQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLACLLDQTNLCRLRSR
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 50% glycerol 0.1M NaCl, 2mM DTT
Other Names Gastric inhibitory polypeptide, Glucose-dependent insulinotropic polypeptide, Gastric Inhibitory Peptide
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap