Home / Products / proteins / Ghrelin, 24-117 aa, Human, His-tag, E.coli

Ghrelin, 24-117 aa, Human, His-tag, E.coli

Categories: [Proteins / Peptides]
Ghrelin, also known as Obestatin, is the ligand for growth hormone secretagogue receptor type 1 (GHSR). It induces the release of growth hormone from the pituitary and involved in growth regulation. This protein has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Ghrelin plays a significant role in neurotrophy, particularly in the hippocampus, and is essential for cognitive adaptation to changing environments and the process of learning.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02238
Size 100 µg
Host E.coli
Accession
Molecular Weight 12.8 kDa (115aa) (Real molecular weight on SDS-PAGE will be shift up)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol, 0.2M NaCl, 0.1mM PMSF
Other Names Appetite-regulating hormone, Obestatin, GHRL, MTLRP, Ghrelin-27, Ghrelin-28, M-46 protein
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap