GFP, 1-238 aa, Aequorea victoria, Recombinant, E.coli

Categories: [Proteins / Peptides]
GFP, also known as green fluorescent protein, is a protein produced by the jellyfish (Aequorea Victoria) that emits bioluminescence in the green zone of the visible spectrum. GFP has become a useful and ubiquitous tool for making chimeric proteins, where it functions as a fluorescent protein tag. It has been expressed in most known cell types and is used as a noninvasive fluorescent marker in living cells and organisms.
List Price: $329
  • Buy 5 for $312.55 each and save 5%
  • Buy 21 for $296.1 each and save 10%
  • Buy 31 for $279.65 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02230
Size 100 µg
Host E.coli
Accession
Molecular Weight 26.8 kDa (238aa)
AP_Mol_Weight
Tag
Sequences MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 10% glycerol
Other Names Green fluorescent protein
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap