Home / Products / proteins / Geminin, Human, Recombinant, His- tagged, E.coli

Geminin, Human, Recombinant, His- tagged, E.coli

Categories: [Proteins / Peptides]
Geminin is a 25 kDa protein, which inhibits DNA replication and is degraded during the mitotic phase of the cell cycle. Geminin controls replication by binding to the licensing factor Cdt1, and is involved in neural differentiation. In addition, geminin directly interacts with Six3 and Hox homeodomain proteins during embryogenesis and inhibits their functions.
List Price: $473
  • Buy 5 for $449.35 each and save 5%
  • Buy 21 for $425.7 each and save 10%
  • Buy 31 for $402.05 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02227
Size 100 µg
Host E.coli
Accession
Molecular Weight 27.6kDa (245aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 100mM NaCl, mM Tris-HCl buffer (pH 8.0) containing 100mM NaCl,
Other Names GMNN
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap