GDF11, 299-407aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
GDF11 also known as growth/differentiation factor 11. The protein secreted signal that acts globally to specify positional identity along the anterior/posterior axis during development. These play critical roles in patterning both mesodermal and neural tissues and in establishing the skeletal pattern. Recombinant human GDF11, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02221
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.8kDa (132aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSNLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid, In 20mM Tris-HCl (pH8.0) containing 10% glycerol
Other Names Growth/differentiation factor 11, BMP-11, BMP11
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap