Home / Products / proteins / GDF-5, 382-501aa, Human, His-tagged, Recombinant, E.coli

GDF-5, 382-501aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Growth differentiation factor 5(GDF-5) is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This protein plays a role in chondrogenesis and chondrocyte metabolism, tendon and ligament tissue formation, and bone repair. It also increases the survival of neurones that respond to a neurotransmitter called dopamine, and is a potential therapeutic molecule associated with Parkinson's disease.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02220
Size 100 µg
Host E.coli
Accession
Molecular Weight 15.8 kDa (141aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 10 mM Sodium citrate pH 3.5, 10% glycerol
Other Names Growth differentiation factor 5, BMP14, CDMP1, LAP4, OS5, SYNS2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap