Home / Products / proteins / GDF-15, 195-308 aa, Human, His-tag, E.coli

GDF-15, 195-308 aa, Human, His-tag, E.coli

Categories: [Proteins / Peptides]
Growth differentiation factor 15 (GDF-15) is a protein belonging to the transforming growth factor beta superfamily that has a role in regulating inflammatory and apoptotic pathways in injured tissues and during disease processes. This protein is most abundant in the liver, with lower levels seen in some other tissues. Its expression in liver can be significantly up-regulated in during injury of organs such as liver, kidney, heart and lung.
List Price: $587
  • Buy 5 for $557.65 each and save 5%
  • Buy 21 for $528.3 each and save 10%
  • Buy 31 for $498.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02219
Size 100 µg
Host E.coli
Accession
Molecular Weight 16.7 kDa (151aa), confirmed by MALDI-TOF (molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 10mM Sodium Citrate (pH3.5) containing 10% glycerol
Other Names Growth differentiation factor 15, GDF-15, MIC-1, MIC1, NAG-1, PDF, PLAB, PTGFB
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap