Home / Products / proteins / GDF-10, 369-478 aa, Human, Recombinant, E.coli

GDF-10, 369-478 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
GDF10 (Growth differentiation factor 10) is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. It is expressed in femur, brain, lung, skeletal, muscle, pancreas and testis, and it plays a role in head formation and may have multiple roles in skeletal morphogenesis. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02218
Size 100 µg
Host E.coli
Accession
Molecular Weight 12.5 kDa (111aa)
AP_Mol_Weight
Tag
Sequences MQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 10 mM sodium citrate (pH 3.5) containing 10% glycerol.
Other Names Growth differentiation factor 10, BMP-3b, BMP3B, BIP
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap