Home / Products / proteins / GCSH, 49-173 aa, Human,His tag, E.coli

GCSH, 49-173 aa, Human,His tag, E.coli

Categories: [Proteins / Peptides]
The enzyme system for cleavage of glycine (glycine cleavage system) is composed of four mitochondrial protein components: P protein, H protein, T protein, and L protein. GCSH is the H protein, which transfers the methylamine group of glycine from the P protein to the T protein.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02214
Size 100 µg
Host E.coli
Accession
Molecular Weight 16.4 kDa (149aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol, 1mM DTT, 0.15M NaCl.
Other Names Glycine cleavage system protein H (aminomethyl carrier), GCE, NKH.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap