Home / Products / proteins / GAMT, 1-236aa, Human, His tag, E.coli

GAMT, 1-236aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Guanidinoacetate N-methyltransferase isoform a, also known as GAMT is a methyltansferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl domor. This enzyme participates in the two-step synthesis of the compound creatine from the protein building blocks glycine, arginine, and methionine.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02193
Size 100 µg
Host E.coli
Accession
Molecular Weight 28.4 kDa (256aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH8.0) containing 1mM DTT,10% glycerol
Other Names Guanidinoacetate N-methyltransferase isoform a, PIG2, TP53I2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap