Galectin-3, 1-250aa, Human, His-tag, E.coli

Categories: [Proteins / Peptides]
Galectin-3 is a member of the family of animal lectins, which selectively binds beta-galactoside residues. This protein is secreted from cells by ectocytosis, which is independent of the classical secretory pathway through the endoplasmic reticulum/Golgi network. Galectin-3 has been associated with the inhibition of apoptosis and the progression of cancer. It is normally distributed in epithelia of many organs, in various inflammatory cells, including macrophages, as well as dendritic cells and Kupffer cells.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02187
Size 100 µg
Host E.coli
Accession
Molecular Weight 28.3 kDa (270aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20 mM Tris-HCl buffer,(pH8.0), 10% Glycerol, 1mM DTT, 0.1M NaCl.
Other Names CBP35, GAL3, GALBP, GALIG, LGALS2, MAC2.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap