Home / Products / proteins / GALE, 1-348aa, Human, His tag, E.coli

GALE, 1-348aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
GALE, also known as UDP-glucose 4-epimeraes, is a protein that functions as the third enzyme in the Leloir pathway of galactose metabolism. It is a homodimeric epimerase found in bacterial, plant, and mammalian cells. This enzyme promotes the reverse chemical reaction, the conversion of UDP-glucose to UDP-galactose.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02185
Size 100 µg
Host E.coli
Accession
Molecular Weight 40.4 kDa (368aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol 5mM DTT, 0.1M NaCl, and 1mM EDTA.
Other Names UDP-glucose 4-epimeraes, SDR1E1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap