Home / Products / proteins / GADD45GIP1, 48-222 aa, Human, His tag, E.coli

GADD45GIP1, 48-222 aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
GADD45GIP1, also known as CRIF1, is a nuclear protein that plays a role in apoptosis control. This protein is expressed in a variety of tissues, including heart, thyroid, trachea, kidney, ovary, pancreas, testis and stomach. It functions as a negative regulator of G1 to S phase cell cycle production, specifically by working with GADD45 proteins to inhibit the activity of cyclin-dependent kinases. Recombinant human GADD45GIP1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02179
Size 50 µg
Host E.coli
Accession
Molecular Weight 22.6 kDa (196aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 40% glycerol 2mM DTT, 0.2M NaCl
Other Names Growth arrest and DNA damage-inducible proteins-interacting protein 1, CKBBP2, CRIF1, MGC4667, MGC4758, PLINP-1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap