GADD45G, 1-159aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
GADD45G is a member of GADD45 family (GADD45α, β, and γ) that are nuclear proteins to interact with various proteins implicated in stress responses and cell-cycle-related proteins. The function of GADD45 proteins is involved in growth-regulatory mechanisms and apoptosis. GADD45G protein responds to environmental stresses by mediating activation of p38/JNK pathway via MTK1/MEKK4 kinase and its transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents.
List Price: $248
  • Buy 5 for $235.6 each and save 5%
  • Buy 21 for $223.2 each and save 10%
  • Buy 31 for $210.8 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02178
Size 100 µg
Host E.coli
Accession
Molecular Weight 17.1 kDa (159 aa)
AP_Mol_Weight
Tag
Sequences MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5)
Other Names Growth arrest and DNA-damage-inducible, gamma, CR6, DDIT2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap