GADD45A, 1-165aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
GADD45A, also known as growth arrest and DNA damage-inducible protein, binds both Cdks and PCNA, a protein involved in DNA replication and repair. It has been shown to stimulate DNA excision repair in vitro and to inhibit entry of cells into S phase. This protein may serve as a link between p53-dependent cell cycle checkpoint and DNA repair. Recombinant human GADD45A protein, fused to His-tag at C-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02177
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.4 kDa (173aa)
AP_Mol_Weight
Tag N-6His
Sequences MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPERLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol0.1M NaCl
Other Names Growth arrest and DNA damage-inducible protein GADD45 alpha, DDIT1, GADD45
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap