Home / Products / proteins / GABARAPL1, 1-117aa, Human, His tag, E.coli

GABARAPL1, 1-117aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Gamma-aminobutyric acid (GABA) receptor-associated protein-like 1, also known as GABARAPL1, belongs to the MAP1 LC3 family. It increases cell surface expression of kappa type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Recombinant human GABARAPL1 protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02172
Size 100 μg
Host E.coli
Accession
Molecular Weight 16.2 kDa (137aa), confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris buffer (pH 8.0) containing 10% glycerol, 1mM DTT, 0.1M NaCl.
Other Names gamma-aminobutyric acid receptor-associated protein-like 1, APG8-LIKE, APG8L, ATG8, ATG8B, ATG8L, GEC1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap