Home / Products / proteins / G-CSF, Human, Recombinant, E.coli

G-CSF, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Human granulocyte colony-stimulating factor(hG-CSF) is one of the hematopoietic growth factors which plays an important role in stimulating proliferation, differentiation, and functional activation of blood cells.In addition to its effect on hematopoiesis, G-CSF also enhances neutrophil functions against bacteria, fungi, and tumor cells mediated by antibody-dependent cell-mediated cytotoxicity.
List Price: $480
  • Buy 5 for $456 each and save 5%
  • Buy 21 for $432 each and save 10%
  • Buy 31 for $408 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02167
Size 50 µg
Host E.coli
Accession
Molecular Weight 18.8kDa (175aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate-buffered Saline(PBS), pH7.4
Other Names Granulocyte-colony stimulating factor, Pluripoietin, CSF3
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap