FXYD5, 22-145aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
FXYD domain-containing ion transport regulator 5, also known as FXYD5, is a cancer-associated cell membrane glycoprotein which belongs to the FXYD family. FXYD5 is involved in down-regulation of E-cadherin, which plays important roles in tumor development and metastasis. It is present in spleen, lung, skeletal muscle, and testis tissue, and maps to human chromosome 19q13.2. Recombinant human FXYD5 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02166
Size 100 µg
Host E.coli
Accession
Molecular Weight 16.1 kDa (147aa) confirmed by MALDI-TOF (Molecular size on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSQTLKDTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKR
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by BCA assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 10% glycerol, 1mM DTT
Other Names FXYD domain-containing ion transport regulator 5, DYSAD, HSPC113, IWU1, KCT1, OIT2, PRO6241, RIC
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap