Home / Products / proteins / FST, 30-317aa, Human, His tag, Insect cell

FST, 30-317aa, Human, His tag, Insect cell

Categories: [Proteins / Peptides]
FST, also known as Follistatin, is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. Recombinant human FST, fused to His-tag at C-terminus, was expressed in Sf9 and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02153
Size 50 µg
Host Insect cell
Accession
Molecular Weight 32.5kDa (295aa) 40-57kDa, reducing conditions
AP_Mol_Weight
Tag N-6His
Sequences MGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate buffer saline (pH 7.4) containing 10% glycerol.
Other Names Follistatin isoform FST344, FS
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap