Frataxin, 42-210aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Frataxin, also known as FXN, is an iron binding protein which belongs to FRATAXIN family. It is an anti-apoptotic protein which prevents mitochondrial damage, reactive oxygen species production and act as either an iron chaperone or an iron storage protein. Frataxin is localized to the mitochondrion and regulating mitochondrial iron transport and respiration.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02148
Size 100 µg
Host E.coli
Accession
Molecular Weight 21.1 kDa (190aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.5) containing 20% glycerol 0.1M NaCl 1mM DTT.
Other Names CyaY, FA, FARR, FRDA, X25, FXN
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap