FOPNL, 1-174aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
FOPNL is involved in the biogenesis of cilia. This protein belongs to the FGFR1OP family and contains 1 LisH domain. FOPNL is widely expressed and detected in brain, heart, kidney, liver, lung, skeletal muscle, placenta and intestine. Recombinant human FOPNL protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02146
Size 100 µg
Host E.coli
Accession
Molecular Weight 21.9 kDa (194aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMATVAELKAVLKDTLEKKGVLGHLKARIRAEVFNALDDDREPRPSLSHENLLINELIREYLEFNKYKYTASVLIAESGQPVVPLDRQFLIHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLGRQPSRRKPMDDHLRKEEQKSTNIEDLHVSQAVNR
Purity > 95% by HPLC
Concentration 1 mg/ml
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol
Other Names FGFR1OP N-terminal like, C16orf63, FOR20, PHSECRG2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap