FOLR1, 26-234aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
FOLR1, as known as folate receptor alpha, is a member of the folate receptor family. This protein meditates the cellular uptake of folic acid and reduced folates. Dietary folates are required for many key metabolic processes including nucleotide ad methionine synthesis, the interconversion of glycine and serine, and histidine breakdown. Also, mature form is an N-glycosylated protein that is anchored to the cell surface by a GPI linkages. Recombinant human FOLR1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $357
  • Buy 5 for $339.15 each and save 5%
  • Buy 21 for $321.3 each and save 10%
  • Buy 31 for $303.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02145
Size 10 µg
Host Baculovirus
Accession
Molecular Weight 25.6kDa (218aa), 28-40kDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADLIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Folate receptor alpha, FOLR1, FBP, FOLR
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap