Fms-related tyrosine kinase 3 ligand, 27-184aa, Human, His tag, Insect cell

Categories: [Proteins / Peptides]
FLT3LG, also known as fms-related tyrosine kinase 3 ligand, is an alpha-cytokine that promotes the differentiation of multiple hematopoietic cell lineages. Also, this protein acts as a growth factor that increases the number of immune cells by activating the hematopoietic progenitors. FLT3LG is crucial for steady-state pDC and cDC development. It controls the development of DCs and is particularly important for plasmacytoid DCs and CD8-positive classical DCs and their CD103-positive tissue counterparts. Recombinant human FLT3LG, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $460
  • Buy 5 for $437 each and save 5%
  • Buy 21 for $414 each and save 10%
  • Buy 31 for $391 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02140
Size 50 µg
Host Insect cell
Accession
Molecular Weight 19.0kDa (166aa), 18-28KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names FLT3LG, Flt3 ligand, Flt3L, FL, SL cytokine
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap