FKBP3, 1-224aa, Human, E.coli

Categories: [Proteins / Peptides]
FK506 binding protein 3 (FKBP3), also known as FKBP25, is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP3 associates with transcriptional repressor protein YY1 and histone deaceltylases, HDAC1 and HDAC2. Also, FKBP3 may contain several casein kinase II phosphorylation sites, which are believed to be important for cell growth regulation. It is localized in the nucleus and is expressed in the brain, testis, ovary, and spleen. Recombinant human FKBP3 was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02136
Size 100 µg
Host E.coli
Accession
Molecular Weight 25.1 kDa (224aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH8.0) containing 1mM DTT, 10% glycerol
Other Names FK506 binding protein 3, FKBP25, PPIase FKBP3, Rotamase
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap