FKBP2, 22-142aa, Human, E.coli

Categories: [Proteins / Peptides]
FKBP2 is peptidyl proline isomerase enzyme and a member of the immunophilin protein family. This protein is predominantly expressed in thymus and T cells and plays a role in immunoregulation and basic cellular processes involving protein folding and trafficking. It is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. FKBP2 is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Recombinant FKBP2 protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02135
Size 50 µg
Host E.coli
Accession
Molecular Weight 13.4 kDa (122aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris buffer(pH 8.0) containing 10% glycerol, 1mM DTT.
Other Names Peptidyl-prolyl cis-trans isomerase FKBP2, FKBP-13, PPIase.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap