FKBP1a /FKBP12, 1-108aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
FK506 binding protein 1a, also known as FKBP12, belongs to the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP12 also plays a role in intracellular calcium regulation by associating with three types of calcium release channel complexes, cardiac and skeletal ryanodine receptors and the inositol 1,4,5-trisphosphate receptor. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. Recombinant human FKBP12, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02132
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.1 kDa (128aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 100 mM NaCl,1mM DTT, 10% glycerol
Other Names FK506 binding protein 1a, 12kDa, PPIase FKBP1A, Rotamase, FKBP1, PKC12
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap