Fkbp1a,1-108aa , Mouse, His tag, E.coli

Categories: [Proteins / Peptides]
Fkbp1a also known as peptidyl-prolyl cis-trans isomerase FKBP1A belongs to the immunophilin protein family, which plays a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Fkbp1a also plays a role in intracellular calcium regulation by associating with three types of calcium release channel complexes, cardiac and skeletal ryanodine receptors and the inositol 1, 4, 5-trisphosphate receptor. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. Recombinant mouse Fkbp1a, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02133
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.4kDa (132aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISSDYAYGATGHPGIIPPHATLVFDVELLKLE
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid, In Phosphate buffered saline (pH7.4) containing 20% glycerol, 1mM DTT
Other Names Peptidyl-prolyl cis-trans isomerase FKBP1A, 12kDa, Fkbp, Fkbp1, FKBP12, FKBP12-T1, FKBP12-T2, mFKBP1, mFKBP12
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap