FKBP14, 20-211aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
FKBP14, also known as 22 kDa FK506-binding protein, is an enzyme that accelerates the folding of proteins during protein synthesis. This protein contains two EF-hand domains and one PPIase FKBP-type domain. Truncation of the amino-terminus of FKBP14 greatly reduces peptidyl prolyl cis-trans isomerase activity, therefore suggesting that the PPIase FKBP-type domain must be located at the N-terminus. Recombinant human FKBP14 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02131
Size 100 µg
Host E.coli
Accession
Molecular Weight 24.2 kDa (213aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid in Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Other Names Peptidyl-prolyl cis-trans isomerase FKBP14, FKBP22
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap