FIBP, 1-364aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Acidic fibroblast growth factor intracellular-binding protein isoform a, also known as FIBP, is a member of Fibroblast growth factors (FGFs) represent a family. FGF activity influences development, adult tissue homeostasis, angiogenesis and cancer progression. FIBP is a 364 amino acid protein that binds to internalized FGF-1 and is thought to be involved in mitogenic function of FGF-1. FIBP localizes to the nucleus and is highly expressed in heart, skeletal muscle and pancreas and at lower levels in brain, placenta, liver and kidney. Recombinant human FIBP protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02129
Size 50 µg
Host E.coli
Accession
Molecular Weight 44.3kDa (387aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVGEAPTDPDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol
Other Names Acidic fibroblast growth factor intracellular-binding protein, FGFIBP, FIBP-1, FIBP1, aFGF intracellular-binding protein
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap