FHL3, 1-280aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
FHL3 is a member of a family of proteins containing a four-and-a-half LIM domain, which is a highly conserved double zinc finger motif. The protein has been shown to interact with the cancer developmental regulators SMAD2, SMAD3, and SMAD4, the skeletal muscle myogenesis protein MyoD, and the high-affinity IgE beta chain regulator MZF-1. This protein may be involved in tumor suppression, repression of MyoD expression, and repression of IgE receptor expression. Two transcript variants encoding different isoforms have been found for this gene. Recombinant human FHL3 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02128
Size 50 µg
Host E.coli
Accession
Molecular Weight 33.6 kDa (303aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol, 1mM DTT
Other Names Four and a half LIM domains 3, SLIM2, NP_004459, SLIM-2, Skeletal muscle LIM-protein 2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap