Home / Products / proteins / FHIT, 1-147aa, Human, His tag, E.coli

FHIT, 1-147aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
FHIT (fragile histidine triad) is an enzyme that cleaves adenosine 5' PPP 5' A to yield AMP and ADP. FHIT gene encompasses the common fragile site FRA3B on chromosome 3. Alterations and deletions of the FHIT gene are strongly linked to the genesis and establishment of human tumors of the lung, cervix, breast, colon, stomach and pancreas.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02126
Size 100 µg
Host E.coli
Accession
Molecular Weight 17.9 kDa(155aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQLEHHHHHH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl Buffer (pH 8.0) containing 10% Glycerol
Other Names Fragile histidine triad protein, Bis (5'-adenosyl)-triphosphatase , AP3Aase.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap