Home / Products / proteins / FGF21, 29-210aa, Mouse, His tag, Insect cell

FGF21, 29-210aa, Mouse, His tag, Insect cell

Categories: [Proteins / Peptides]
FGF21, also known as fibroblast growth factor 21, is a member of the fibroblast growth factor family. It has a hydrophobic amino terminus, which is a typical signal sequence, and appears to be a secreted protein. It stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression. Recombinant mouse FGF21, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02121
Size 50 µg
Host Insect cell
Accession
Molecular Weight 21.0kDa (190aa), 18-28kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYASLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Fibroblast growth factor 21
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap