Ferric uptake regulator(FUR), 1-148 aa E.coli, Recombinant, E.coli

Categories: [Proteins / Peptides]
Fur (ferric uptake regulator) protein is a DNA-binding protein which regulates iron-responsive genes. Fur is a small, 17-kDa, global transcriptional repressor that in the presence of iron regulates functions as diverse as iron acquisition, oxidative stress, and virulence. In Escherichia coli, members of the Fur family regulate the expression of more than 100 genes that function in processes as varied as the biosynthesis and transport of siderophores, the expression of virulence factors, the alleviation of oxidative and NO-induced stress, and the inhibition of ferritin production through the expression of RyhB.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02112
Size 100 µg
Host E.coli
Accession
Molecular Weight 16.7kDa (148aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 2 mM CaCl2, 100 mM NaCl
Other Names DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap