Fcgrt, 22-297aa, Mouse, His-tag, Baculovirus

Categories: [Proteins / Peptides]
Fcgrt, as known as IgG receptor FcRn large subunit p51, is a transmembrane glycoprotein with structural homology to MHC class 1 proteins. This protein is widely expressed in endothelial and epithelial cells and plays an important rloe in IgG homeostasis. Also, it is expessed in neutrophils and myeloid antigen presenting cells. It can enhance IgG-meditated phagocytosis and antigen presentation by heses cells, but it promotes the degradation of opsonizing IgG rather than returning it to the circulation. Recombinant mouse Fcgrt, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $357
  • Buy 5 for $339.15 each and save 5%
  • Buy 21 for $321.3 each and save 10%
  • Buy 31 for $303.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02107
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 32.1kDa (285aa), 40-57kDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPSETRPPLMYHLTAVSNPSTGLPSFWATGWLGPQQYLTYNSLRQEADPCGAWMWENQVSWYWEKETTDLKSKEQLFLEALKTLEKILNGTYTLQGLLGCELASDNSSVPTAVFALNGEEFMKFNPRIGNWTGEWPETEIVANLWMKQPDAARKESEFLLNSCPERLLGHLERGRRNLEWKEPPSMRLKARPGNSGSSVLTCAAFSFYPPELKFRFLRNGLASGSGNCSTGPNGDGSFHAWSLLEVKRGDEHHYQCQVEHEGLAQPLTVDLDSSARSSHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names IgG receptor FcRn large subunit p51, Fcgrt, FcRn
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap