Home / Products / proteins / FCGR2A, 34-216aa Human, His tag, E.coli

FCGR2A, 34-216aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
Low affinity immunoglobulin gamma Fc region receptor II-a, also known as FCGR2A, is a member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. This protein is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Recombinant human FCGR2A protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $357
  • Buy 5 for $339.15 each and save 5%
  • Buy 21 for $321.3 each and save 10%
  • Buy 31 for $303.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02103
Size 20 µg
Host E.coli
Accession
Molecular Weight 23.0 kDa (208aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMQAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSRLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMG
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 50% glycerol, 1mM DTT
Other Names Low affinity immunoglobulin gamma Fc region receptor II-a, CD32, CD32A, CDw32, FcGR, IGFR2, MGC23887, MGC30032
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap