Home / Products / proteins / FASLG, 130-281aa, Human, His tag, E.coli

FASLG, 130-281aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Fas ligand, also known as FASLG, belongs to the tumor necrosis factor family and is the ligand for FAS. Both are transmembrane proteins. Interaction of FAS with this ligand is critical in triggering apoptosis of some types of cells such as lymphocytes. Defects in FASLG may be related to some cases of systemic lupus erythematosus (SLE). Recombinant human FASLG protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02093
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.6kDa (173aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M urea, 10% glycerol
Other Names Tumor necrosis factor ligand superfamily member 6, APT1LG1, CD178, CD95L, FASL, TNFSF6
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap